SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805797|ref|YP_005842195.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805797|ref|YP_005842195.1|
Domain Number 1 Region: 313-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-42
Family RecA protein-like (ATPase-domain) 0.000000659
Further Details:      
 
Domain Number 2 Region: 142-313
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.1e-33
Family Intein (protein splicing domain) 0.008
Further Details:      
 
Domain Number 3 Region: 30-92
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000108
Family DNA repair protein Rad51, N-terminal domain 0.0032
Further Details:      
 
Domain Number 4 Region: 72-141
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000163
Family RecA protein-like (ATPase-domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805797|ref|YP_005842195.1|
Sequence length 515
Comment DNA repair and recombination protein RadA [Fervidicoccus fontis Kam940]
Sequence
MVPKSQKTSESEDLEEEKKKDEEKDESEINAIKTLTDLPGIGPATATKLIEAGYGTLEAI
AVATPQEISAAVGIPINTAQRAIKAARDALEIRFKTALELKKERQSVGKITTGSKSLDDL
LGGGVETRTMTEFFGEFGTGKCFSPETEVIIEDFGSVKKIDIESFYEMKASEGKELMYDG
GFMVPLLNKNKVITFSGNRMELSEAEYIYKQKVEKLVEIKLSNGEKIEVTLSHPFLVSSK
GKLVWKKSYTLKEGDEVPVFETSGVLSQKSNERFNIEKIVEKKLVNRKGFVYDLVVPGTH
NFLSASGLILHNTQISHQLSVNVQLPPDKGGLSGRAVYIDSEGTFRWERIEAMARALGLN
PDEVMENIFYIRAVNSDHQMAVVEEVTKMIQEKGIKLVVVDSITGHFRAEYPGRENLASR
QQKLNRHLHQLMRIAEIYNIAVVITNQVMARPDVFYGDPTQAVGGHVLYHAPGVRVQLRK
SRGNKRIAKVVDAPHLPEGEVVFSITEYGIRDAEE
Download sequence
Identical sequences I0A186
gi|385805797|ref|YP_005842195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]