SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805895|ref|YP_005842293.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805895|ref|YP_005842293.1|
Domain Number 1 Region: 22-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.01e-56
Family Extended AAA-ATPase domain 0.00017
Further Details:      
 
Domain Number 2 Region: 296-402
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.98e-24
Family Helicase DNA-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805895|ref|YP_005842293.1|
Sequence length 407
Comment ORC complex protein Cdc6/Orc1 [Fervidicoccus fontis Kam940]
Sequence
MLKLQNEDFLDEVFKSIKRASIFLDRDKLTPDYVPENLPFREEQIKKIASILAQALRNSR
PNNIFTYGLTGTGKTAVVKLVTKKLQERAVELKLPIQTVYVNCRQRDTSYRVLADIIESL
GGHVPFTGLSLAELYRRLISKLESLGGRFIVILDEIDFIIKKQGDDLLYKLTRINEELKN
SSLSMIGITNDLNFIDNLDPRIRSSLGEEEIVFPPYNALQLKSILEDRAKIAFRTGALDE
GVIDLCAALAAREHGDARKALDLLRVAGEIAEREGDEKVRKEHVEKARKELEKDKVYEVV
STLPLHAKLILASIVDLTRRGKDSATTGEIFVEYSKKTSELRLETLTQRRVTDIISELDM
MGLVSARVISRGRYGKTKVVKLIANLNTVLNALKDDEILESVVDVDK
Download sequence
Identical sequences I0A1I4
gi|385805895|ref|YP_005842293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]