SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806059|ref|YP_005842457.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806059|ref|YP_005842457.1|
Domain Number 1 Region: 101-270
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.46e-33
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.011
Further Details:      
 
Domain Number 2 Region: 10-105
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.4e-16
Family Ferredoxin reductase FAD-binding domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385806059|ref|YP_005842457.1|
Sequence length 279
Comment Sulfhydrogenase subunit gamma [Fervidicoccus fontis Kam940]
Sequence
MVRNDILVPSIANVKEIINETSDIKTYKLFSNAEKAQKFKPGQFVMVYLKGFGEVPISLS
DLVYEEDGGSLITLTIRGTGTVTKYMLSTVNIGDKIGIRGPYGNNWPIEEALGKDILIAG
GGIGFAPLRPVLRFVSNNRQKFGRLVVIYGARSPNDIIYKYEIEEYKKIPGIELFLTIDK
PAEDWKWNVGFVPDMLDKVKLDGDFKYFVCGPEIMMKITAKKLVNKGADPRDIFVSLERR
MRCGVGICGTCQLGHYYVCKDGPVFSFDQVSQYMEVEGI
Download sequence
Identical sequences I0A1Z8
gi|385806059|ref|YP_005842457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]