SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806157|ref|YP_005842555.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806157|ref|YP_005842555.1|
Domain Number 1 Region: 94-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.58e-51
Family Nitrogenase iron protein-like 0.000000395
Further Details:      
 
Domain Number 2 Region: 298-433
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 3.01e-32
Family Signal peptide-binding domain 0.0000306
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 1.07e-20
Family Domain of the SRP/SRP receptor G-proteins 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385806157|ref|YP_005842555.1|
Sequence length 453
Comment signal recognition 54 kDa protein [Fervidicoccus fontis Kam940]
Sequence
MSNIFSGIKEAIKKFLSSTSPYEQSVEEFIRELQRILIKSDVNVKVVFEFTSKIRKRALE
EKPPQGVSRRDWFIKIVYEELISLLGGEEELNVLPKKKPYVIMLVGVQGSGKTTTAAKLA
WYYKNRGYRVGLIAADTFRAGAYEQLKQLAEKVGVEFWGDKGLNDPAEISRKGLEYHLSK
KAEIIIIDTAGRHGYGEESKLIDEMKAIADAVKPDEVILVLDASIGQKAYDLAKKFHEAT
PIGSIIITKLDGTAKGGGAISAIAATGAKVKFVGTGEKVDEIEPFRPKNFASRILGMGDI
EAILERVYSTMSQNELEEMADSLMSGNLNMKLIYKQIKQIRSMGPIGKILRMIPGLSMSL
PEDEGALKVSEKKMDMWLNIINSMTYEEMEKPELLEREKSRIRRIAIGAGVAQEDVRELL
NYYNYIKKLLKQLKRRKSLLKKFGGADEFLEEE
Download sequence
Identical sequences I0A296
gi|385806157|ref|YP_005842555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]