SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806185|ref|YP_005842583.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806185|ref|YP_005842583.1|
Domain Number 1 Region: 5-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000699
Family Nucleotide and nucleoside kinases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385806185|ref|YP_005842583.1|
Sequence length 195
Comment Dephospho-CoA kinase, CoaE [Fervidicoccus fontis Kam940]
Sequence
MLGDMRKLILITGMPGSGKSIVSSYFKSRGYTVYSMGDIVRNIAEERGVEKTLENLLSIA
QEIRNKYGPSGVAKLMIPILEKEKSETVVIDGVRSINEIGEFKKVSKCINIIAVYSPPYM
RFERLLYRGRPGDPRSFEELIERDLKELSFGIGNVISLSDFMIINDESPSKVIDYLKSKE
DEICNCKKESVWKYL
Download sequence
Identical sequences I0A2C4
gi|385806185|ref|YP_005842583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]