SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806202|ref|YP_005842600.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806202|ref|YP_005842600.1|
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-22
Family PF0610-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385806202|ref|YP_005842600.1|
Sequence length 119
Comment putative transcriptional regulator consisting of an HTH domain fused to a Zn-ribbon [Fervidicoccus fontis Kam940]
Sequence
MSGEENFLTTREKIYLILKNSPIPLTVEDIINMLGYSVREKRKVEEDIEHLALSLKSRSN
GKERIAILPARCLNCGYTFKDNRKAKRPSKCPKCKSFRIEGPWFYITESSSSMKGSILL
Download sequence
Identical sequences A0A2J6N3D8 I0A2E1
gi|385806202|ref|YP_005842600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]