SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806210|ref|YP_005842608.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806210|ref|YP_005842608.1|
Domain Number 1 Region: 190-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000319
Family Tandem AAA-ATPase domain 0.04
Further Details:      
 
Domain Number 2 Region: 499-548,584-660
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000044
Family N-acetyl transferase, NAT 0.037
Further Details:      
 
Weak hits

Sequence:  gi|385806210|ref|YP_005842608.1|
Domain Number - Region: 104-183
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0179
Family Protein-L-isoaspartyl O-methyltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385806210|ref|YP_005842608.1|
Sequence length 826
Comment putative P-loop ATPase fused to an acetyltransferase [Fervidicoccus fontis Kam940]
Sequence
MKREEIEAIASDYIKTIGKEPPHEIKKFARRLRDNTEKYVKLKYRRLVVVSGGDEKKQGF
ISGYITYHYLLELSRLRGGKKLKLLYMYHDEYEEARIRKETFRQFMKMARKKLQNIERNI
DVYEKSDRYLGTSYDVLILDLTNDLRPNDIGKLVEIVNGGGLIIFLTPDLEKWDRWMTAF
KQKLVVPGFNEPRHIFIRWFKETILDSDSTYVYDAEKDQLVKKFYVQRVKGEEKKSEVVR
EKGLKEKHIFDERLYSLALTEDQQKVLEVMEELLGKTKKKKVLVITSNRGRGKSSVLGIG
VIALANHMSQFKHKVRILVTAPEITNVQSLFDLAYLSAKSIGLNVKLLKKGGMIIEIQGQ
NFSIEYWEPINIPKIKGDVVVVDEASGISVPLLLKILKTHKRLIFSATIHGYEGAGRGFS
VRFLGSLRKDPNVELSTCEMKTPIRYGEGDPIEKWLYRALLLDAEPTDLSDDDLTKIKNQ
ELEYVYLDPAELFKKENEELLRQLFGIFVLAHYRNQPDDLAMMADAPHHMIRAVMIKGTN
KIVCSLQIAVEGGLDSQTVDTLLRGNKIQGNIIPDRIIKHLRIWEMGWLRGYRIVRIATH
PEVQNLGIGSFALERLYEEARQKSFDWIGSGFGANYSLLNFWIKNKFIPVHISPDKNPIS
GEYTVIVIRPINHIAEKITREGQIYLRKKIVKGMRDVYKEMEQDLALLILNSIEKMEIEI
PKLHPIDVDRLWIYVYGPMTYEAISDVFLDLAIYYFLGDMEKLVELNNEEKIILLAKVLQ
GKDWSEMSKMLRRRRIDLMLILKDIAKRMLNSYYNKNLESSVGYHI
Download sequence
Identical sequences A0A2J6N6Q5 I0A2E9
gi|385806210|ref|YP_005842608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]