SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806263|ref|YP_005842661.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806263|ref|YP_005842661.1|
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000029
Family RecA protein-like (ATPase-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385806263|ref|YP_005842661.1|
Sequence length 188
Comment hypothetical protein FFONT_1221 [Fervidicoccus fontis Kam940]
Sequence
MKENRESVRIFLTGHPGIGKTTLVLKLASILTLEKVKFAGFATPEKRGKSGREGFELIIF
PSNEVHELASKSIEKGYKMKLGSYYVNENMGAIILKIINEYLNDDSFKFFIGDEVGPMEL
MIPGIREGILKLLKAEEKSMLMSFHINLKQKDPEIYDLISKGDVYVLSTENRNQILNDII
NKIRRKII
Download sequence
Identical sequences A0A2J6N7U2 I0A2K2
gi|385806263|ref|YP_005842661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]