SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385806380|ref|YP_005842778.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806380|ref|YP_005842778.1|
Domain Number 1 Region: 8-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-48
Family Ribonuclease PH domain 1-like 0.00000211
Further Details:      
 
Domain Number 2 Region: 153-239
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.71e-27
Family Ribonuclease PH domain 2-like 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385806380|ref|YP_005842778.1|
Sequence length 246
Comment exosome complex exonuclease 1 [Fervidicoccus fontis Kam940]
Sequence
MSHNSNRKLIDENGLRVDGRRPDQLRPISMKVGILKNAQGSALVSYGKTQVMAAVYGPRE
ALPRHMTLPDRAILRIRYHMAPFSTSERKSPAPTRREIELSKVIREALEATVFSELFPRT
TIDVFIEVLQADGGTRTTSLTAASLALADAGIPMKDLIAGVAVGKVDGVLVLDINEIEDS
TGQADMPVAIMPNLNKIVLLQLNGTLTRDEFNEALKMAQKAIKEIYIMQKEALREKYSSM
EEVEQA
Download sequence
Identical sequences A0A2J6N5A0 I0A2W9
gi|385806380|ref|YP_005842778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]