SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00008263m|PACid:23808607 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00008263m|PACid:23808607
Domain Number 1 Region: 130-222
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000435
Family 7-Fe ferredoxin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00008263m|PACid:23808607
Sequence length 427
Sequence
WGSGRGRSHGRRPVPLPPPPLLASHAAVRAAASAVCRSRRARRAGDQPPQVAALLRGDWV
KLICGASFEDAADVRNLSLVYTLAGVDCIDCAADASVVGAVNEGIDVAASIIPAVQRPWV
MVSVNDDCRDLHFRKAEFDPEDCPPDCSKPCEKVCPADAISLESVMVGEHTQSDPLHGKF
KGGVLTERCYGCGRCLPVCPYDRIRAVSYVRDPTTTSELLKRNDVDAIEIHTTGKGTDTF
NTLWNSLRESISNVKLVAVSMPDIGESTVDFMNALYAIMEPHIQGYNLWQLDGRPMSGDI
GRGATRETVSFAVHMASVSERPPGFYQLAGGTNSYTVDCLKKAGLFRSTTFPGTATSEMI
GSQQTLIGGIAYGGYARKIIGRTLRKVPAQFGCVRIEDHPEHLLEALQEALSLVGPVKGY
PALSSLS
Download sequence
Identical sequences Pavirv00008263m|PACid:23808607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]