SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00016748m|PACid:23779661 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00016748m|PACid:23779661
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.41e-16
Family 7-Fe ferredoxin 0.0000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00016748m|PACid:23779661
Sequence length 81
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASTPRTEDCVGCKRCESACPT
DFLSVRVYLGSETTRSMTLSY
Download sequence
Identical sequences Pavirv00016748m|PACid:23779661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]