SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00020460m|PACid:23806687 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00020460m|PACid:23806687
Domain Number 1 Region: 117-179
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000419
Family 7-Fe ferredoxin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00020460m|PACid:23806687
Sequence length 397
Sequence
MAAVPVPPPPLLASHAAVRAAASAVSRSRRARLSGDQPPQVAALRRGDWVKLICGASFED
AADVRNLSLVYTLAGVDCIDCAADASVVGAVNEGIDVAASIIPAAQRPWRLDCPPDCSKP
CEKVCPADAISLESIMVGEHTQSDPLHDKLKGGVLTERCYGCGRCLPVCPYDRIRAVSYV
RDPTTTSELLKRNDVDAIEIHTTGKGTDTFNTLWNSLSESINNVKLVAVSMPDVGESTVD
FMNALYAIMEPHIQGYNLWQLDGRPMSGDIGRGATRETVSFAVHMASVSERPPGFYQLGG
GINSYTIDCLKKAGLFQSTTFPGTATSETIGSHQTLIGGIAYGGYARKVIGRTLRKIPAQ
FGCVRIEDHPEHLLEALQEALSLVGPVKGYPALSSLS
Download sequence
Identical sequences Pavirv00020460m|PACid:23806687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]