SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00024435m|PACid:23782222 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00024435m|PACid:23782222
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000248
Family ABC transporter ATPase domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00024435m|PACid:23782222
Sequence length 73
Sequence
MARLFFHCPKYGILDECTNATSVDVEEHLYRIATNIGITVITSSQRPALIPFHSLELKLI
DGEGKWELCAIHQ
Download sequence
Identical sequences Pavirv00024435m|PACid:23782222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]