SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00027581m|PACid:23760571 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00027581m|PACid:23760571
Domain Number 1 Region: 52-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-21
Family Extended AAA-ATPase domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00027581m|PACid:23760571
Sequence length 188
Sequence
MKKMMDIVTKTTTRHEIGQEIKDIKERVKEVAERRDRYKVDAIKPAKTLVDPRITALYTK
ATYLVGIDDAREELITRLTKGDDMSAQQQRVVSIVGFGGLGKTTLAKAVYDQLRVQFDCT
AFVSVSQNPDLNKLLKNMLYELDKEKYSNIHSTMLEEKHLIDLVREFLQNKSYGWYYFVS
VYLSIHFM
Download sequence
Identical sequences Pavirv00027581m|PACid:23760571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]