SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00033820m|PACid:23781835 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00033820m|PACid:23781835
Domain Number 1 Region: 18-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.87e-39
Family G proteins 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00033820m|PACid:23781835
Sequence length 194
Sequence
MSFLVDWLFDVLASLGLWQKEAKILFLGLDNSGKTTLLHMLKEERLTQHAPTQHPTSEEL
RIGRINFRASDLGGHRIACRVWRDYYASVDAVVYMVDTADGARLAESRAELGALLSDDAL
AGVPFLVLGNKIDVQQAAPENVLAYYLGLAGCTTGKGAVDLADTGVRPLEVFMCSVVRNM
GYGEGFRWMSQYMK
Download sequence
Identical sequences Pavirv00033820m|PACid:23781835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]