SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00036232m|PACid:23781762 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00036232m|PACid:23781762
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000183
Family Ubiquitin-related 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00036232m|PACid:23781762
Sequence length 118
Sequence
MVSPCRKQEDSVSVEAIAARLLRVRSMVAAVIKPVMLVTLKVQDTDRRVVKRTMLRTDKL
QGLMDYYYDVVLGPADAGARHAGRFIFDGKRVKGEHTPEDLNMVNGDKIDFFQDLLSG
Download sequence
Identical sequences Pavirv00036232m|PACid:23781762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]