SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00036476m|PACid:23817145 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00036476m|PACid:23817145
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.57e-32
Family Phosducin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00036476m|PACid:23817145
Sequence length 168
Sequence
MRLAELREAAKAARFGSILPITGSDFVREVSQAPSDIWVVVFLYKDGIPECGLLQNCLEE
LATRYPATKFVKIISTDCIPNYPDRNVPTILVYNNSAVKGTYVGLQKFGGKRCTPESVAL
ALCQSDPVLNDGHGGSDSSRDNVIEGVRRKFIEKVVAQHEEREEEDSD
Download sequence
Identical sequences Pavirv00036476m|PACid:23817145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]