SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00056458m|PACid:23795165 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00056458m|PACid:23795165
Domain Number 1 Region: 154-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000104
Family Extended AAA-ATPase domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00056458m|PACid:23795165
Sequence length 238
Sequence
MEVVGVTTGVMKPLLAKLTKLLGEEYAKLKGARKQIEFLRDELSAMSATLEVLADAEQLN
PERRLWRDKLRELAYDLEDCIDGFMARVDDGRDGPTGFIKKCSRKLKKLKARHDIANQIQ
ELKAYVMEASERHKRYNCLEIPSNSSTYCAVDPRLAALYVEIDELVGIDGPKKHIIEWLS
MEKKASSAAPKVLSIVGCGGLGKTTLANQVYKNVKGQFSCAAFLSLSRNPDIKKILLK
Download sequence
Identical sequences Pavirv00056458m|PACid:23795165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]