SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00060803m|PACid:23797616 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00060803m|PACid:23797616
Domain Number 1 Region: 90-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.68e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0000137
Further Details:      
 
Domain Number 2 Region: 8-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.4e-29
Family Glutathione S-transferase (GST), N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00060803m|PACid:23797616
Sequence length 224
Sequence
MAEVEATAGQLRLYSYYRSSCSHRARIALNLKGVDYEYKAVNLLKGEQSDPEFLKLNPMK
FVPALVDDDAVIGDSYAIALYLEDKYPDPPLLPQDPRKKALNHQIANIVSSGIQPLHNLS
VLRFIEQKVGAGESVLWTQQQIERGFTAIENLIQLKDCAGKYATGDEVQLADVFLAPQIY
AAIEHTKIDMSNYPTLARLHAEYMAHPAFQAALPGNQPDAPPST
Download sequence
Identical sequences Pavirv00060803m|PACid:23797616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]