SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00069081m|PACid:23818772 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00069081m|PACid:23818772
Domain Number 1 Region: 58-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000166
Family Ubiquitin-related 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00069081m|PACid:23818772
Sequence length 150
Sequence
MSPPAKLGHRAEEEEERGTGTTPVRVGRRVESEDREVDEQERATTTEPAEVKAEAGVDGS
LINIKVRSQTAANECFRVKRDVKLERLISMYCGKHSLNPMAVRFLDPSGRYIRAAQTPDE
VGLEDGDEISIHLHQLGGTGAPLQASPSSA
Download sequence
Identical sequences Pavirv00069081m|PACid:23818772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]