SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00000218m|PACid:23779223 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00000218m|PACid:23779223
Domain Number 1 Region: 132-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000269
Family Thioltransferase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00000218m|PACid:23779223
Sequence length 306
Sequence
PGAPAIAGVHVVRLTSSTLGSLELEKALPRAPEPAAARAPTRLAPRTPTMTPPNEPEDID
AWALMAGLEDHSPLLTAPFGRHSFSFPVATAPQELAASAKVTPLPMPQPHAAAVATDVGE
GKAGKEKAPPRRAVLYFTSLRGVRATYEDCCLARAILKGYGVRLDERDVSMHRGFRDELS
GLLGVASGGALAAKCWAPAAPALPSLFVDGELVGNAEELKRLHEAGELAVRLAGCESAAA
AGDAGACEACGDVRFVLCKTCSGSCKVYVYDEGEQDDASGEDGGGGFRRCPDCNENGIVR
CPACCC
Download sequence
Identical sequences Pavirv00000218m|PACid:23779223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]