SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00000408m|PACid:23809559 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00000408m|PACid:23809559
Domain Number 1 Region: 309-450
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-21
Family UAS domain 0.00044
Further Details:      
 
Domain Number 2 Region: 501-608
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000253
Family UBX domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00000408m|PACid:23809559
Sequence length 611
Sequence
MADETLAAFMDATGCGYDDSFRRLASCGGHLGRAVSRFFNVEAGSSGSRRSPPPPSRVEE
VSSDTDGDDAPAPAPAARSERRARERSPPSCSSPKAVSKSKRRDGEARGGGGSKSSRRRR
RRRRRDREAGGGENSRGEKKRRRVREDDGPSRSGREEAGGGRKSSRRRRRSRDNSDSEEK
AEANNRSLRRRRRLNPKDPTSDSDKEEDGSNSTLRRRLPEDISSDGDKKVRASDSSSCRL
LEHISSDSDGDKKQVQANDSGRRRLDRGNVPAPDGGGGKKEDGPRFRENISSSSSDDDDG
DMVVYEAPPPPRPANSRRTVEGLFQAPRELTYKGVFHDAMAHAARRARWLLVNVQRGLEF
ASLVQNRDVWGSDMVAQWVRGSFVLWQADADARGGEREEAEKVLGYYKVPRDRLPVVVVV
DPVTGQAVDRLHGADPNDFLVAMGPYTDKAPAMPVVGAKKPGATPGAQTNQKPATTTAPT
VRKPAEAAVAVAPPPGQARREQPAAVRKPAEPVATAVAEVPTGQQPAATAAKVCKLRVRL
PDGRVVAKEFGSQCAVAELFAHCRSELGEAAEKRPFRLLRFVGAARQEIGDERASFESLR
LHMSTVCVELG
Download sequence
Identical sequences Pavirv00000408m|PACid:23809559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]