SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00001983m|PACid:23759604 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00001983m|PACid:23759604
Domain Number 1 Region: 158-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-29
Family B3 DNA binding domain 0.0000171
Further Details:      
 
Domain Number 2 Region: 29-85
Classification Level Classification E-value
Superfamily DNA-binding domain 1.37e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00001983m|PACid:23759604
Sequence length 343
Sequence
MDAAEPGAEADSGGAGRAAAVVGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTG
EAEAARAYDVAAQRFRGRDAVTNFRPLAESDPESAAELRFLASRSKPEVVDMLRKHTYVE
ELAQNRRAFTAVSPLPPPKNPAASSPPSGASAAAAREHLFNKTVTPSDVGKLNRLVIPKQ
HAEKHFPLQLPAAASVVTGECKGVLLNFEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVK
EKGLHAGDAVGFYRSAGKQLFIDCKVRPKTTAFANAATMPPPAVKAVRLFGVDLLTAPRP
PTVAPEQEEMLPVMTNKRARDAFAASTTPHMIFKKQCIDFALT
Download sequence
Identical sequences Pavirv00001983m|PACid:23759604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]