SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00002539m|PACid:23785650 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00002539m|PACid:23785650
Domain Number 1 Region: 74-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000125
Family Glutathione peroxidase-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00002539m|PACid:23785650
Sequence length 164
Sequence
MAAPVSASLAPRVSLPPRARSAASSSRGLGLASLPGRRHRHLRLRRSPSPAGTAAASSAS
VPSPSGIGDALGGVEVYSAATGEPVLFRDLWDQNEGMAVVALLRHFGCPCCWELAAVLRD
TKERFDSAGVKLIAVGVGTPAKARILAERLPFPLEYLYADPERK
Download sequence
Identical sequences Pavirv00002539m|PACid:23785650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]