SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00004642m|PACid:23789064 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00004642m|PACid:23789064
Domain Number 1 Region: 131-221
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-18
Family Thioltransferase 0.016
Further Details:      
 
Domain Number 2 Region: 52-62
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000146
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00004642m|PACid:23789064
Sequence length 339
Sequence
MGCVSSAFLEEEAEDGRRRIISHHHIVSLTSSTYGILTYSEPPHPTKTTSAPPPPPPPPP
PPTNDLKPETHPQPEEVINSWELMAGLVDPSTPARPPAPSPSCRPKRRIRFPLRPIDGNA
KPGARAPPPAASAVLYTTSLRGVRATFEACNAVRAALQAHGVAFRERDVSMDRSFREELR
QQLLSPAACSLPRLFVRGRHVGGAEEVLRLEEQGLLAPLLEGLPRSGTYSCDGCGGMSFL
PCFDCSGSRKVAVPVPGNQPGCRRRTTVVVRCGECNENGLGVKSHGSLVRPAGPPPPALA
LRKRAPSMRTLCVELSSAPFMWSMTLAVVGYRKGPPGAL
Download sequence
Identical sequences Pavirv00004642m|PACid:23789064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]