SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00004786m|PACid:23806792 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00004786m|PACid:23806792
Domain Number 1 Region: 353-441
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.24e-21
Family DEP domain 0.0048
Further Details:      
 
Domain Number 2 Region: 243-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000311
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00004786m|PACid:23806792
Sequence length 569
Sequence
MESTDKDEKNLVVTEECTNPGENCEDEGDLSRKTEMLNVEESTNSSNVGLSNESEAQIEV
GRNSEKDLNGQMNESASSDAMEPLHSNQITKDIHVEDKSEEPVFDGTEVPEMEEMRRSSN
QSAELDSEAQVSVINEWAVAIKNFVKEKSAIAVSTFMRRLSGKKDENEFKVEADKSDGSE
CIDSEKTGSDAEPKTKEVQQKTDERTAWNPLNLIKFGRDFDTFTTGEAGPEDVPNLSEQS
KVKGRIIIYTKLGCEDCKMVRLFLHQKRLKYVEINIDIFPSRKLELEKNSGSSSVPKVYF
NDLLIGGLVELKKMEDSGILDENIGVLFKEEPSSSAPLPPLPGEDDESGSGKMDELATIV
RKMRESVTPKDRFYKIRRFSNCFLGSEAVDFLSEDQYLERDEAVEFGRKLGSKYFFRHVV
DENVFEDGNHLYRFLDHEPIVMTQCYNIPRGIIDVAPKPIAEVASRLRLLSYAIFEAYVS
VDGRHVDYRSIQDCEEFKRYIRTIEELQRVEIDDLSREEKLAFFINLYNMMAIHALVTCG
VPAGPLDRRKFFGDFKYVIGGCLLLYLLL
Download sequence
Identical sequences Pavirv00004786m|PACid:23806792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]