SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00005298m|PACid:23818576 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00005298m|PACid:23818576
Domain Number 1 Region: 143-242
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000949
Family Thioltransferase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00005298m|PACid:23818576
Sequence length 270
Sequence
MEVATATEASAPAASGSAARQNHSFPWLDAAISEPYYFLHLLAFFSYFAARSAAIAADDG
GELYHRLLRRIQAVLVFLVLFVVKIVREETWETFIADSLLYAKGLLLAVTLVIDYWLALG
YFLGFVVIYAVAQQPPYHGLGHSNHLTPLQLESLLTEEPTSRFWLVEFRTLFSATCIQAS
SVLPELSNIYSNKNISFGIIDLGHFPNAAAKFGISMWDHLPTYILFDKATEVARFPEVTS
ESKVFVPKVTKKLLCQHFDLDRRLIEYLST
Download sequence
Identical sequences Pavirv00005298m|PACid:23818576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]