SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00005732m|PACid:23816949 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00005732m|PACid:23816949
Domain Number 1 Region: 68-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-34
Family Thioltransferase 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00005732m|PACid:23816949
Sequence length 171
Sequence
MAASATAARPLAGASAPLPFSARPQPARVALLPRAPAAIRGLSLGRPAQAQPSARGRSVR
CLAALSPEMRATLDKVVGSSKVVLFMKGTKDFPQCGFSHTVVQILRSLDVPFETLDVLAN
EALRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQETLEKAMCS
Download sequence
Identical sequences Pavirv00005732m|PACid:23816949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]