SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00006353m|PACid:23815523 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00006353m|PACid:23815523
Domain Number 1 Region: 52-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-24
Family UAS domain 0.075
Further Details:      
 
Domain Number 2 Region: 252-368
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-24
Family UBX domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00006353m|PACid:23815523
Sequence length 371
Sequence
SRSYVVVVAARPRAAPSASAPWVAGGVLSRSLSLLGLAGQAGGDRLLELPPSAAEAAEFV
AEFEREFGAGRGPRFVAEGFADALQRAQREFKLLFVYLHSPDHPDTPAFCGGCLCAEPVA
AFIDENFVAWGGSIRRTEGFKMSNSLNASRFPFCAVVMASTNQRIMLLQQVEGPKSPEEM
ITILQRVVEECATSLVAARIEAEERLNNQRLREEQDAAYRAALEADQARERERLEELERR
EREAAEAERKRKEEEEALARAAQEAAEKEAALARRRQEKAMALGAEPDKGPGVTRVLIRF
PTGERKERRFHSSAPITSLYDYVDSLDCLEAEKYSLVSNFPRVTYGPEKHSLTLEQAGLH
PQASLFIEIEQ
Download sequence
Identical sequences Pavirv00006353m|PACid:23815523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]