SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00008378m|PACid:23795806 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00008378m|PACid:23795806
Domain Number 1 Region: 176-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.23e-32
Family Glutathione peroxidase-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00008378m|PACid:23795806
Sequence length 277
Sequence
MRARASHLRALLSRVLAPGLAPPPGRAMPQVPQRLSLRRWRPPSAGSSLTLLVLFLLQIT
GPGASRFGAAFLGRARFSSADASTAAQGGSKPPAAAAAATTTGGDGGGDGHSGKSEQADA
GKSVRGGPVSWLSFLLLLVTGGGIIVYYDKEKKRHIEEMKNRTSAVKPGQSVGTAAIGGP
FKLLNHDGKPVTEKDFLGKWTLLYFGFTHCPDICPDELQKMAAAIDKIKGKAKLDIVPVF
ITVDPERDTVEQVRDYVKGVCPCTVPSRSGRTDGHDG
Download sequence
Identical sequences Pavirv00008378m|PACid:23795806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]