SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00010644m|PACid:23762268 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00010644m|PACid:23762268
Domain Number 1 Region: 187-282
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.99e-28
Family Thioltransferase 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00010644m|PACid:23762268
Sequence length 314
Sequence
MYLLTLHGNELPSGESELALQEATRGQELLACKSVILRWAASGFKLGLKTSERLHRAVSR
ARPGKSENERSSIRLLRFSFSHRPPFSFAAVSRPRRRILPFLSSSPLIWSRLVSSPCPAP
PSSTLLASARPSPQRKIRAITRAKFMNYSSGLGGAPNAIGDSTTTRVAADPDTHQDFQPT
SKSSEMSFDDIVAQDIKEHPVVIYMKGYPDAPRCGFSALAVKVLQQYGVPISARDILSDL
KLKETVKAYSNWPTFPQIFIKGEFVGGSDIILSMHQASQLIKTGFELLWLLDDKGELKEL
LGDIAQKGEQNDSS
Download sequence
Identical sequences Pavirv00010644m|PACid:23762268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]