SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00010677m|PACid:23788845 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00010677m|PACid:23788845
Domain Number 1 Region: 374-470
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.32e-17
Family UBX domain 0.061
Further Details:      
 
Domain Number 2 Region: 85-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000082
Family UAS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00010677m|PACid:23788845
Sequence length 551
Sequence
MRAGGLWEAVATLSGDRSSKGFSVNSPGNFLQKSPCRPAAGRPGPGRPAAGRPGTSPTPP
TAAPCSPTLSSSSFSAAATRDPDRPRVMERTINSLTYKGSIPDAINQSRRQKKLFVVYIS
GEDEASSSLEQSTLVDENVVEVIGRCCIFLHLKQGNVDASQFSAIYPQKSVPSISVIGLN
GVMLWNHEGHISSENMKESIEKAWAALHLQETAATLLTASLASRNAEPVNTTTTLLPQGG
SATSEDPSVSSSAPYISGASGVAHSAELVSQLPSTTNHDELVEIDEKQGEGSKSDPGGIA
VEKIDSACTEVGCDLPISSRSVSMGSSANPEDEDSTPSLKRKNKDDGTCAAVPVVATPST
SSSRGVSTQLLVQQDSVTSSAPDEPVSSSVKSDDIQLSIRMPSGNRLEMKLTKQDVLRKV
KNFVDENKGSGLGSYDLSLVYPKRIFSDQDMETTLYELGIQNRHAMIVVPHRQPVQVSRL
QSSSSYAGDSSGGGGYFGYLRTIMSYANPLSYLRGNPTTSRPELEPNEGRPSGPWSERRP
LPGNRGQEADR
Download sequence
Identical sequences Pavirv00010677m|PACid:23788845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]