SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00011821m|PACid:23768058 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00011821m|PACid:23768058
Domain Number 1 Region: 99-238
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-23
Family UAS domain 0.00055
Further Details:      
 
Domain Number 2 Region: 303-402
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000031
Family UBX domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00011821m|PACid:23768058
Sequence length 403
Sequence
REIEPTGWGEAEPGDGGEENVYGGQVPDDAEREDGCNNEDEGGGSNEDDNDQHSNMSYSD
NEMNDDDDYWTGMDEDDSYYDASLAEDDGAEGGGEPPRRQPQSSLAEMYQLPFDLMCGGS
FHDAKVRAAREDQFLLVNLQTRSGAGDFQSQLHNRDLWSDERVKNVVRGGFVFFLVQKRS
SYLHQDECAKVSSFYKLEDDQLPAVLVLDPITGQLLGRRSGAMTPDEFIEYVDGYTKSKP
STMSMPKFVKRTFAPTEISAPAAAAVEQEPAAPEISAPAGASCSEEEPPAPVAETEAPAE
MAAADDDEPMEGEKMCKLRIRLPDGTTVAKEFGCRRRVASLFAFCRSAVHGRGGGGEAAA
EQQRAFRIMRFARGGFEAVQGGGGVTFEDLRLNNAAVSVVFDA
Download sequence
Identical sequences Pavirv00011821m|PACid:23768058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]