SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00015887m|PACid:23824924 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00015887m|PACid:23824924
Domain Number 1 Region: 73-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.9e-64
Family Glutathione peroxidase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00015887m|PACid:23824924
Sequence length 232
Sequence
SVIPSNPPTPRGPGRYKSPEPVTSRLGPLSALGFVCTLPPGRRFSPTQLSSSSSPPTPPA
PRPSMAAASSATSVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELAQLY
EKYKDQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGNNATPLYKF
LKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
Download sequence
Identical sequences Pavirv00015887m|PACid:23824924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]