SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00017734m|PACid:23794049 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00017734m|PACid:23794049
Domain Number 1 Region: 104-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000153
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00017734m|PACid:23794049
Sequence length 183
Sequence
MIIKTLKARILRALKSSLPAAGADSPPTKPAAASVHADAFSDDASFFDAREPETPTKGRR
HPSSSPEPLDAWELVDQDGRAVPAPPAGDPAPAPDPLLGFPARCPPGGERGVVLYTTTLR
GVRRTFEDCNGVRALLENLAVAFQERDVSMDRGLRDQLWAVTGEKAVPPRLFARGRDVGG
AAQ
Download sequence
Identical sequences Pavirv00017734m|PACid:23794049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]