SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00018255m|PACid:23781245 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00018255m|PACid:23781245
Domain Number 1 Region: 80-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.46e-27
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00018255m|PACid:23781245
Sequence length 188
Sequence
MTTAAAVLPACAAGPLSQAPAPLPRRLLSIQPSPARRDGSRGCSLAGSSGSRAPTVRRNA
AAETVVPYVPGSGKYIAPDYLVKKVSAKEVEELVRGERNVPLIVDFYATWCGPCVQMAQD
IEMLAVEYEDNALFVKVDTDDEYEFAKDMQVRGLPTLYFFSPDQSKDAIRTEGLIPMDMI
RNIIDNEL
Download sequence
Identical sequences Pavirv00018255m|PACid:23781245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]