SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00018395m|PACid:23814233 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00018395m|PACid:23814233
Domain Number 1 Region: 256-416
Classification Level Classification E-value
Superfamily eEF1-gamma domain 3.4e-61
Family eEF1-gamma domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 77-214
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.16e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0052
Further Details:      
 
Domain Number 3 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00018395m|PACid:23814233
Sequence length 416
Sequence
MALVLHAGSGNKNAFKALIAAEYSSIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP
DGPVFESNAIARYVTRLKDDNPLYGSSLIDYAHIEQWMDFAATEVDASIGKWLYPRMGFY
PYAAVSEETAIAALKRALGSLNTHLASNTFLVGHSVTLADIVLTCNLYLGFIRILTKSFT
SEFPHVERYFWTMVNQPNFKKVIGDVKQAEAVPPVPKKAAPAKEQKPKEAKKEAPKETLK
PKADEKPAEEEPKPKPKNPLDLLPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEG
YSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFR
GSEIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK
Download sequence
Identical sequences Pavirv00018395m|PACid:23814233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]