SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00022195m|PACid:23771388 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00022195m|PACid:23771388
Domain Number 1 Region: 206-327
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.96e-23
Family Elongation factor TFIIS domain 2 0.0034
Further Details:      
 
Domain Number 2 Region: 335-395
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 8.84e-20
Family Transcriptional factor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 23-98
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 6.8e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00022195m|PACid:23771388
Sequence length 397
Sequence
MDRELLETFEAAKKAADAAAGEHDSPEAERCLDALRRLRDIRVNTDVLVSTQVGKRLRHL
TKHPHSGIQAVATDLFGYWKKVVLEETGKKNGSSENERSSDSSGKIEKARPVKIERNSSS
SSMKIERSSDSSGKFEKERPVKVERNSSSSSMKVEKRDVDVRGQRPDSVKVEKTASNGSK
AQPAKVERVSKEVSRTPDTKKTASVPTGPPKLTSLVKCNDATRDKIRELLAEAFSKVPGE
TSNDDRDEVRNILDQVNACDPFRVAVTVESALFEKLGRSTGAQKAKYRSIMFNLRADNNT
DFRRRVLIGQVRPERLPDISAQEMASDARKQENEQIKEKALLECERGGAPKATTDQFKCG
RCGQRKTTYYQLQTRSADEPMTTFVTCVNCNNHWKFC
Download sequence
Identical sequences Pavirv00022195m|PACid:23771388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]