SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00022400m|PACid:23824422 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00022400m|PACid:23824422
Domain Number 1 Region: 16-119,147-278
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 1.19e-44
Family Plant cytotoxins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00022400m|PACid:23824422
Sequence length 296
Sequence
MAAANPPSATNPLFTVTFDVQGSDNYGDFIAGIRRRVANPRHFSHNRPVLPPVEPPPRRW
FHIVLRTQIATLTLTTRADNLYLEGFRSSDGTWWELTRGLIPGATYVGFGGSYGDLLGNT
FRLAGGALERLGPQQQADAAKALAARASLGLAGVELGPQQMADAANALAARARGDLASGK
EQQRASEALVVILLMVHEATRFATVSAFVAALMHPRAAMKRGTITAQMEKQVNGWEDLSK
SLLMADAVRPPGPFKPFPDMGVSTVEEAAATIAILLFVELPGGMTAAKALQLFHGN
Download sequence
Identical sequences Pavirv00022400m|PACid:23824422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]