SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00022889m|PACid:23769714 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00022889m|PACid:23769714
Domain Number 1 Region: 168-240
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 266-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000602
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000327
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 34-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000576
Family CCCH zinc finger 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00022889m|PACid:23769714
Sequence length 301
Sequence
MDAGRKRAVPEGANGAGGPKRARELETTQMGVGSKSKPCTKFFSTAGCPFGASCHFLHNF
PGGYQAVSKMTNLGGPPVPAPPGRMPMGPGAPDGPPSPAMKTRMCNKYNTAEGCKWGSKC
HFAHGERELGKPMQMDNSMGVPPMGPGPNGHFMPPPMPVPDMVPPSTFGASATAKISVDA
SLAGAIIGKGGTNTKHISRVTGAKLAIRDNEADPNLKNIELEGTFDQIKHASAMVTELIV
RISGKAPPQSKNNPGRGSHAGGPGSNFKTKLCENFSKGSCTFGDRCHFAHGESELRKPAA
A
Download sequence
Identical sequences Pavirv00022889m|PACid:23769714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]