SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00023704m|PACid:23805622 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00023704m|PACid:23805622
Domain Number 1 Region: 25-70,103-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000392
Family Thioltransferase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00023704m|PACid:23805622
Sequence length 230
Sequence
MASPRFPLLLRLVPLVLLCLSPACAAGRVPVSVYYETLCPFCSAFVVNDLARIFHDGVSI
ADLRLVPFGNGRVSADGSITCQHGEGECQLNAIEACVIRLWPNAEQHFPFVQCVERLALT
RKWDAWQSCFQETGLVSQPVIDCYNSGYGRQLELQNAAETNALQPPHQFVPWVVVNGKLL
GEDYMNFEAYICSFYDGELPEACKGKHLAIAQHTRTSGGDKVCSVSKIIS
Download sequence
Identical sequences Pavirv00023704m|PACid:23805622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]