SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00024180m|PACid:23793082 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00024180m|PACid:23793082
Domain Number 1 Region: 113-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.5e-31
Family Thioltransferase 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00024180m|PACid:23793082
Sequence length 238
Sequence
MWRATRQYKYTATYNAFVLDPVQEIQASKEFAGRLHKFRKYQYSQLPFSPNSGGGAKGFP
SVSAALLAPNPSAAPDSGPSSFARCQQLRMVLKCLRRCCCCSAKHTDGEDKIDFGGSNVH
VITSKENWDQKIEEANKDGKIVVANFSASWCGPCRVISTVYAEMSQTYPQLMFLAVDVDE
LMEFSSSWDIRATPTFFFLKNGQQVDKLVGANKPELEKKVAAVAGDRDGNGGAVPDAK
Download sequence
Identical sequences Pavirv00024180m|PACid:23793082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]