SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00025247m|PACid:23796680 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00025247m|PACid:23796680
Domain Number 1 Region: 219-374
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.48e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0073
Further Details:      
 
Domain Number 2 Region: 103-205
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000179
Family Thioltransferase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00025247m|PACid:23796680
Sequence length 390
Sequence
MWATPPQPLPLQLRRPPGLPPRLFLTRHRSSRLNRIAASQDPLTALSRLLWGRALPPAQL
VLAVRHGWTAAWQLLMRQLAPSDPETGAFTRTPSGFPTVVGTPSSRLHLYVGLPCPWAHR
ALVVRALLGLEARLPVSVAVPGDDGAWSFTPDNPDGLYGKRKLREVYAVRSGGFEGRASV
PMLWDAERREVVCNESIEISKFLCGLANADGGGLDLWPPELRQDIDRWYGVIYPSVNNGV
YRCGFAQNQEAYDAAASELFGALDRLEAHLGGCRYLCGDRLTLADVCLFTTLIRFDLVYN
TLFRCTRRKLGEYPSLHAYTRDIYQMPKVAETCDMEAIMAGYFKTLFPLNPGGIQPLPPA
SCDSESLLRPHGREALSSAAGTPLQAAGVS
Download sequence
Identical sequences Pavirv00025247m|PACid:23796680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]