SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00025579m|PACid:23824416 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00025579m|PACid:23824416
Domain Number 1 Region: 75-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-28
Family Glutathione peroxidase-like 0.011
Further Details:      
 
Domain Number 2 Region: 181-203,247-296
Classification Level Classification E-value
Superfamily YWTD domain 0.00000994
Family YWTD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00025579m|PACid:23824416
Sequence length 306
Sequence
ARKGLNSITILGAWTIRKHRNQCVLDGASPNVAEALLLAREELYFWSLAGGDSLSSRAQQ
IKKYLADFEFGGSATYAPEFPRKLDWLNTAPLQFGRDLKGRVVLLDFWTYCCINCMHVLP
DLEFVEKKYKDKPFTVVGVHSAKFDNEKDLDAIRNAVLRYKITHPVVNDGDMYLWRELGV
NSWPTFVLIGPNGKVLAQISGEGHRKDLDDVVGAALEFYEDKKLLRNDPLPLALEKDKDS
RLLTSPLKFPGKLALDVENNRVFISDSNHNRIVVTNLEGQFICQVGSSEEGLLDGPFDAA
LFNRPQ
Download sequence
Identical sequences Pavirv00025579m|PACid:23824416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]