SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00027921m|PACid:23821751 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00027921m|PACid:23821751
Domain Number 1 Region: 35-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-30
Family PDI-like 0.0078
Further Details:      
 
Domain Number 2 Region: 246-373
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000123
Family Calsequestrin 0.083
Further Details:      
 
Weak hits

Sequence:  Pavirv00027921m|PACid:23821751
Domain Number - Region: 182-257
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00137
Family PDI-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00027921m|PACid:23821751
Sequence length 419
Sequence
MATRVLPPTLLPLLLLLLLLPLSARATAAAGEEFPRDGRVIDLDESNFEAALGAIDFLFV
DFYAPWCGHCKRLAPELDEAAPVLAGLSEPIVVAKVNADKYRKLGSKYGVDGFPTLMLFI
HGVPIEHTGSRKADQLVRNLKKFVAPDVSILESDTAIKNFVENAGTSFPMFLGFGVNESL
IAEYGRKYKKRAWFAVAKDFSEDIMVAYDFDKVPALVAIHPKYREQSLFYGPFEGNFLED
FVRQSLLPLVVPINTETLKMLNDDERKVVLIILEDDSDENSTQLVQVLKSAANANRDLVF
GYVGIKQWDEFVETFDVSKSSQLPKLLVWDRNEEYELVDGSERLEEGDHASQISQFLEGY
RAGRTTKKKVSGPSFMGFLNSLVSMNSLYILIFVIALLVVMVYFAGQDDTPQPRRVHEE
Download sequence
Identical sequences Pavirv00027921m|PACid:23821751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]