SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00027997m|PACid:23786644 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00027997m|PACid:23786644
Domain Number 1 Region: 70-212
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.05e-31
Family UAS domain 0.049
Further Details:      
 
Domain Number 2 Region: 311-393
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-24
Family UBX domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00027997m|PACid:23786644
Sequence length 395
Sequence
MSSGPARGSGSSSAGESLRNSCNDFARTLARLPASIMEGLSRSIPRRRRHHHPIPHRLQP
PPQAPSLLPPPFVPEELFFFSVFEQQYGAHHPFFYACRFADALRAARREGKLVFVYLHDP
GHPYTEPFCRRTLCSDVVVEFLDANFVSWGAVSGTGEGPGMVASLQPGSFPFCAIVAPVS
DESIAVLQQVEGPVSPSELVEILQRTIDEQGAAFRASRPDEQAAAIRSARTAEEEERRRS
ALRLRQEQDAAYLESLRRDQEKERSRKSLQEGAAKPRAGNQLRARHPGQAARQPTKPTQI
RASPQKETAASQRTEPNTKIMIRFPNGERRQQSFHHTDTVKDVYRYVDSLGIPGIGRYQL
VRSYPRKTYGQQQLGMTLGDAGFYPSVTLYIEQLS
Download sequence
Identical sequences Pavirv00027997m|PACid:23786644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]