SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00028697m|PACid:23812818 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00028697m|PACid:23812818
Domain Number 1 Region: 81-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.51e-16
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00028697m|PACid:23812818
Sequence length 178
Sequence
SETRVPQQSVRANRSKATPASRRGASGDAIPYSSARPWLMPAAEAGAVSVKPEPPAAAAT
GAEEPARPDAAAGDDDGGRAEVERAVAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHE
VADEAALAGVVPPGGAEAAALPAVFVGGKLLGGLDRLMAVHIAGELVPILKKAGALWL
Download sequence
Identical sequences Pavirv00028697m|PACid:23812818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]