SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00029442m|PACid:23804837 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00029442m|PACid:23804837
Domain Number 1 Region: 678-791
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.35e-28
Family Thioltransferase 0.00077
Further Details:      
 
Domain Number 2 Region: 205-235,276-628
Classification Level Classification E-value
Superfamily L domain-like 5.78e-24
Family Leucine rich effector protein YopM 0.09
Further Details:      
 
Domain Number 3 Region: 11-155
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-17
Family G proteins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00029442m|PACid:23804837
Sequence length 793
Sequence
MFTLSFLFASYFVVLDDVWSIRTWKVISCALPNNDKTADRILITTCKKDVKESCCIHPTD
AVYQMEGLGNKNSKILFDSKIPSSKKHSQLEGSDEMLKMCGGMPLAITITAGLLLRKSAC
LPLDQYHSEQQGMRKILEISYDDLTLPVKSCFLYLSAFPENYTIKKDRLIRRWIAERFIP
KKNEESLWEIGESYFNELISRRLIQPAFDDDDDHPTGCTIHDDVFDFIESLSSEENFVTA
GAKLKSGLFPCDSVRRVCLDCDEDDEGDTLFSSTYCTLEQNSRDSSDDEQNSSSDKDEAT
SLHLSQVRSLAFYGDVRRIPDLSIFKFVRVLDLTDGKGLENEQLESIGRLSLLRYLGLGG
TKVTKVPQQIMKLDHLSTLDLRQTKVKKLPESEGSKLVSLLANGLTIPRGIGGMESLEEL
STVCLRGNALFHEDMIGLVHRLRGLRMLGVKFSNITEEEEEGLKYFLDELGSSNLQFLFL
DEYPHHLLGLLLDVWTHVRSGCLQKFELRMDWLHFFRYPERVPQTISFLEDLTHLHIGVL
VVEAQGVRALGSLPKLVVLKLYSYNSPRFSVSSKDGFQCLKVFWYCCEHGTASGLQFEAG
AMPHLRRLLLDINASATDFVSGIWHLSCLIQVRGTIYCGSTSTASALEASIRDQVSENPN
KPLLELNRKRKGRLLPRPEPPLEESVVEIQDEEEWYDQIDEANSANKLVVVEFTAKWCGP
SRFIAPVFADLSSKFPDVVFLKVDIDKLKRIAKGFGVTGAPEFYFIRGGEVKGSVDGANV
RELKAKLMQQMNQ
Download sequence
Identical sequences Pavirv00029442m|PACid:23804837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]