SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00029910m|PACid:23787577 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00029910m|PACid:23787577
Domain Number 1 Region: 152-264
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-19
Family UAS domain 0.039
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily UBA-like 0.000051
Family TAP-C domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00029910m|PACid:23787577
Sequence length 270
Sequence
MAETVDDKVSYFQAVTGISDPDLCTEILAAHNWDLQVAVSSITANPSSPSASASTSSREQ
GPSAPLADAEFVAPPPPMPMPPAPQQQQQQQPGIAWKLVTLPFYVVSGGLGLVAGTFRFG
AWVAGGVLSRSLSLLGLAGQAGGDRLLELPPSAAEAAEFVAEFEREFGAGRGPRFVAEGF
ADALQRAQREFKLLFVYLHSPDHPDTPAFCGGCLCAEPVAAFIDENFVAWGGSIRRTEGF
KMSNSLNASRFPFCAVVMASTNQRIMLLQQ
Download sequence
Identical sequences Pavirv00029910m|PACid:23787577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]