SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00029911m|PACid:23767758 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00029911m|PACid:23767758
Domain Number 1 Region: 201-267
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-20
Family DNA-binding domain from rap30 0.0031
Further Details:      
 
Domain Number 2 Region: 3-135
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 2.43e-17
Family Rap30/74 interaction domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00029911m|PACid:23767758
Sequence length 275
Sequence
MGEEAKYLETARADRSVWLMKCPPVVSRAWEAASASASASSSSDAANPNPVVAKVVLSLD
LLSNEEPSLQASPPQSSPPPPFKMELAQTNTGNTPKSYSLNMFQDFVPMCVFSESNQGKL
SCEGKVEHKFDMEPHSDNLVNYGKLCRERTQKYMVKSRQVQVLDNDHGMSMRPMPGMVGL
IPSGSREKKKQTPAKPSDVKRTRRDRTEMENIIFKLFERQPNWALKALVQETDQPEQFLK
EILNDLCVYNKRGPNQGTHELKPEYKKSTGDTDAA
Download sequence
Identical sequences Pavirv00029911m|PACid:23767758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]